Protein Info for Rv1568 in Mycobacterium tuberculosis H37Rv

Annotation: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase BioA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR00508: adenosylmethionine-8-amino-7-oxononanoate transaminase" amino acids 21 to 430 (410 residues), 542.8 bits, see alignment E=2.2e-167 PF00202: Aminotran_3" amino acids 35 to 428 (394 residues), 369.6 bits, see alignment E=8.8e-115

Best Hits

Swiss-Prot: 100% identical to BIOA_MYCBO: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (bioA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00833, adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC: 2.6.1.62] (inferred from 100% identity to mtc:MT1619)

MetaCyc: 51% identical to adenosylmethionine-8-amino-7-oxononanoate aminotransferase (Escherichia coli K-12 substr. MG1655)
Adenosylmethionine--8-amino-7-oxononanoate transaminase. [EC: 2.6.1.62]

Predicted SEED Role

"Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)" in subsystem Biotin biosynthesis (EC 2.6.1.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>Rv1568 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase BioA (Mycobacterium tuberculosis H37Rv)
MAAATGGLTPEQIIAVDGAHLWHPYSSIGREAVSPVVAVAAHGAWLTLIRDGQPIEVLDA
MSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGLDTVFF
SDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTD
VLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDL
RDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTAD
VAHTISAGAAGALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTAR
ALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYAMPPYICTPAEIT
QITSAMVEVARLVGSLP