Protein Info for Rv1557 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane transport protein MmpL6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 328 to 354 (27 residues), see Phobius details PF03176: MMPL" amino acids 29 to 364 (336 residues), 350.8 bits, see alignment E=3.4e-109

Best Hits

Swiss-Prot: 100% identical to MMPL6_MYCTO: Probable transport protein MmpL6 (mmpL6) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K06994, putative drug exporter of the RND superfamily (inferred from 100% identity to mtu:Rv1557)

Predicted SEED Role

"Transmembrane transport protein MmpL6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>Rv1557 Probable conserved transmembrane transport protein MmpL6 (Mycobacterium tuberculosis H37Rv)
VQGISVTGLVKRGWMVRSVFDTIDGIDQLGEQLASVTVTLDKLAAIQPQLVALLPDEIAS
QQINRELALANYATMSGIYAQTAALIENAAAMGQAFDAAKNDDSFYLPPEAFDNPDFQRG
LKLFLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIYLAGTAAT
FKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLVWQ
HLLGIQLYWIVLALAVILLLAVGSDYNLLLISRFKEEIGAGLNTGIIRAMAGTGGVVTAA
GLVFAATMSSFVFSDLRVLGQIGTTIGLGLLFDTLVVRAFMTPSIAVLLGRWFWWPQRVR
PRPASRMLRPYGPRPVVRELLLREGNDDPRTQVATHR