Protein Info for Rv1553 in Mycobacterium tuberculosis H37Rv

Annotation: Probable fumarate reductase [iron-sulfur subunit] FrdB (fumarate dehydrogenase) (fumaric hydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF13085: Fer2_3" amino acids 7 to 110 (104 residues), 112.3 bits, see alignment E=3.8e-36 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 9 to 229 (221 residues), 262.7 bits, see alignment E=1.2e-82 PF13237: Fer4_10" amino acids 146 to 216 (71 residues), 35.5 bits, see alignment E=2.8e-12 PF13183: Fer4_8" amino acids 146 to 219 (74 residues), 50.2 bits, see alignment E=1.1e-16 PF00037: Fer4" amino acids 147 to 164 (18 residues), 25.1 bits, see alignment (E = 4.1e-09) PF12838: Fer4_7" amino acids 149 to 219 (71 residues), 34.6 bits, see alignment E=7.4e-12 PF13534: Fer4_17" amino acids 149 to 220 (72 residues), 34.5 bits, see alignment E=9e-12

Best Hits

Swiss-Prot: 100% identical to FRDB_MYCTO: Fumarate reductase iron-sulfur subunit (frdB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to mtf:TBFG_11585)

MetaCyc: 50% identical to fumarate reductase iron-sulfur protein (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>Rv1553 Probable fumarate reductase [iron-sulfur subunit] FrdB (fumarate dehydrogenase) (fumaric hydrogenase) (Mycobacterium tuberculosis H37Rv)
MMDRIVMEVSRYRPEIESAPTFQAYEVPLTREWAVLDGLTYIKDHLDGTLSFRWSCRMGI
CGSSGMTINGDPKLACATFLADYLPGPVRVEPMRNFPVIRDLVVDISDFMAKLPSVKPWL
VRHDEPPVEDGEYRQTPAELDAFKQFSMCINCMLCYSACPVYALDPDFLGPAAIALGQRY
NLDSRDQGAADRRDVLAAADGAWACTLVGECSTACPKGVDPAGAIQRYKLTAATHALKKL
LFPWGGG