Protein Info for Rv1552 in Mycobacterium tuberculosis H37Rv

Annotation: Probable fumarate reductase [flavoprotein subunit] FrdA (fumarate dehydrogenase) (fumaric hydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01176: fumarate reductase (quinol), flavoprotein subunit
  • amino acids 2 to 582 (581 residues), 1130 bits, E=0
• TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  • amino acids 7 to 581 (575 residues), 731.4 bits, E=6.9e-224
• PF00890: FAD_binding_2
  • amino acids 7 to 394 (388 residues), 380.2 bits, E=2.3e-117
• PF02910: Succ_DH_flav_C
  • amino acids 455 to 581 (127 residues), 133.5 bits, E=7.1e-43

Best Hits

Swiss-Prot: 100% identical to FRDA_MYCBO: Fumarate reductase flavoprotein subunit (frdA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 100% identity to mbb:BCG_1604)

MetaCyc: 55% identical to fumarate reductase flavoprotein subunit (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• TCA cycle VI (Helicobacter) (9/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• mixed acid fermentation (13/16 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• succinate to cytochrome aa₃ oxidase electron transfer (2/2 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• TCA cycle III (animals) (7/10 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• NADH to fumarate electron transfer (1/2 steps found)
• hydrogen to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)
• methylaspartate cycle (11/19 steps found)
• L-glutamate degradation VIII (to propanoate) (5/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Protein Sequence (583 amino acids)

>Rv1552 Probable fumarate reductase [flavoprotein subunit] FrdA (fumarate dehydrogenase) (fumaric hydrogenase) (Mycobacterium tuberculosis H37Rv)
MTAQHNIVVIGGGGAGLRAAIAIAETNPHLDVAIVSKVYPMRSHTVSAEGGAAAVTGDDD
SLDEHAHDTVSGGDWLCDQDAVEAFVAEAPKELVQLEHWGCPWSRKPDGRVAVRPFGGMK
KLRTWFAADKTGFHLLHTLFQRLLTYSDVMRYDEWFATTLLVDDGRVCGLVAIELATGRI
ETILADAVILCTGGCGRVFPFTTNANIKTGDGMALAFRAGAPLKDMEFVQYHPTGLPFTG
ILITEAARAEGGWLLNKDGYRYLQDYDLGKPTPEPRLRSMELGPRDRLSQAFVHEHNKGR
TVDTPYGPVVYLDLRHLGADLIDAKLPFVRELCRDYQHIDPVVELVPVRPVVHYMMGGVH
TDINGATTLPGLYAAGETACVSINGANRLGSNSLPELLVFGARAGRAAADYAARHQKSDR
GPSSAVRAQARTEALRLERELSRHGQGGERIADIRADMQATLESAAGIYRDGPTLTKAVE
EIRVLQERFATAGIDDHSRTFNTELTALLELSGMLDVALAIVESGLRREESRGAHQRTDF
PNRDDEHFLAHTLVHRESDGTLRVGYLPVTITRWPPGERVYGR