Protein Info for Rv1543 in Mycobacterium tuberculosis H37Rv

Annotation: Possible fatty acyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00106: adh_short" amino acids 54 to 246 (193 residues), 156.1 bits, see alignment E=1.6e-49 PF08659: KR" amino acids 56 to 225 (170 residues), 48.7 bits, see alignment E=1.7e-16 PF13561: adh_short_C2" amino acids 63 to 249 (187 residues), 108.2 bits, see alignment E=9.9e-35

Best Hits

Swiss-Prot: 100% identical to Y1570_MYCBO: Uncharacterized oxidoreductase Mb1570 (BQ2027_MB1570) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_11576)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>Rv1543 Possible fatty acyl-CoA reductase (Mycobacterium tuberculosis H37Rv)
MNLGDLTNFVEKPLAAVSNIVNTPNSAGRYRPFYLRNLLDAVQGRNLNDAVKGKVVLITG
GSSGIGAAAAKKIAEAGGTVVLVARTLENLENVANDIRAIRGNGGTAHVYPCDLSDMDAI
AVMADQVLGDLGGVDILINNAGRSIRRSLELSYDRIHDYQRTMQLNYLGAVQLILKFIPG
MRERHFGHIVNVSSVGVQTRAPRFGAYIASKAALDSLCDALQAETVHDNVRFTTVHMALV
RTPMISPTTIYDKFPTLTPDQAAGVITDAIVHRPRRASSPFGQFAAVADAVNPAVMDRVR
NRAFNMFGDSSAAKGSESQTDTSELDKRSETFVRATRGIHW