Protein Info for Rv1540 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein member of yabO/yceC/yfiI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR00005: pseudouridine synthase, RluA family" amino acids 13 to 305 (293 residues), 299.5 bits, see alignment E=1.3e-93 PF00849: PseudoU_synth_2" amino acids 90 to 243 (154 residues), 92.9 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 100% identical to Y1567_MYCBO: Uncharacterized RNA pseudouridine synthase Mb1567 (BQ2027_MB1567) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 100% identity to mbt:JTY_1567)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>Rv1540 Conserved hypothetical protein member of yabO/yceC/yfiI family (Mycobacterium tuberculosis H37Rv)
MADRSMPVPDGLAGMRVDTGLARLLGLSRTAAAALAEEGAVELNGVPAGKSDRLVSGALL
QVRLPEAPAPLQNTPIDIEGMTILYSDDDIVAVDKPAAVAAHASVGWTGPTVLGGLAAAG
YRITTSGVHERQGIVHRLDVGTSGVMVVAISERAYTVLKRAFKYRTVDKRYHALVQGHPD
PSSGTIDAPIGRHRGHEWKFAITKNGRHSLTHYDTLEAFVAASLLDVHLETGRTHQIRVH
FAALHHPCCGDLVYGADPKLAKRLGLDRQWLHARSLAFAHPADGRRVEIVSPYPADLQHA
LKILRGEG