Protein Info for Rv1539 in Mycobacterium tuberculosis H37Rv

Annotation: Probable lipoprotein signal peptidase LspA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 33 to 178 (146 residues), 94.2 bits, see alignment E=4.1e-31 PF01252: Peptidase_A8" amino acids 39 to 178 (140 residues), 116.1 bits, see alignment E=7.7e-38

Best Hits

Swiss-Prot: 100% identical to LSPA_MYCTO: Lipoprotein signal peptidase (lspA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to mbo:Mb1566)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>Rv1539 Probable lipoprotein signal peptidase LspA (Mycobacterium tuberculosis H37Rv)
VPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVTKVVAVQLLPP
GQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSPWWALGL
GMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPSVVGGAILLVILSIFGF
DFDTVGRRHADGDTVGRRKADG