Protein Info for Rv1513 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01444: methyltransferase, FkbM family
  • amino acids 43 to 190 (148 residues), 100 bits, E=7.9e-33
• PF05050: Methyltransf_21
  • amino acids 45 to 215 (171 residues), 83.7 bits, E=8.7e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtc:MT1563)

MetaCyc: 69% identical to [alpha-L-fucopyranosyl-(1->3)-alpha-L-rhamnopyranosyl-(1->3)-2-O-methyl-alpha-L-rhamnopyranosyl] dimycocerosyl phenol-phthiocerol 2'''-O-methyltransferase (Mycobacterium tuberculosis H37Rv)
2.1.1.M14 [EC: 2.1.1.M14]; 2.1.1.M14 [EC: 2.1.1.M14]

Predicted SEED Role

"gsc"

MetaCyc Pathways

• p-HBAD biosynthesis (8/9 steps found)
• dimycocerosyl triglycosyl phenolphthiocerol biosynthesis (9/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.M14

Protein Sequence (243 amino acids)

>Rv1513 Conserved protein (Mycobacterium tuberculosis H37Rv)
MRLARRARNILRRNGIEVSRYFAELDWERNFLRQLQSHRVSAVLDVGANSGQYARGLRGA
GFAGRIVSFEPLPGPFAVLQRSASTDPLWECRRCALGDVDGTISINVAGNEGASSSVLPM
LKRHQDAFPPANYVGAQRVPIHRLDSVAADVLRPNDIAFLKIDVQGFEKQVIAGGDSTVH
DRCVGMQLELSFQPLYEGGMLIREALDLVDSLGFTLSGLQPGFTDPRNGRMLQADGIFFR
GSD