Protein Info for Rv1511 in Mycobacterium tuberculosis H37Rv

Annotation: GDP-D-mannose dehydratase GmdA (GDP-mannose 4,6 dehydratase) (GMD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 2 to 321 (320 residues), 496.3 bits, see alignment E=2.3e-153 PF01370: Epimerase" amino acids 4 to 247 (244 residues), 237.7 bits, see alignment E=1.3e-74 PF16363: GDP_Man_Dehyd" amino acids 5 to 315 (311 residues), 453.9 bits, see alignment E=4.3e-140

Best Hits

Swiss-Prot: 61% identical to GMD2_ARATH: GDP-mannose 4,6 dehydratase 2 (MUR1) from Arabidopsis thaliana

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to mra:MRA_1523)

MetaCyc: 61% identical to GDP-mannose 4,6-dehydratase subunit (Arabidopsis thaliana col)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.47

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>Rv1511 GDP-D-mannose dehydratase GmdA (GDP-mannose 4,6 dehydratase) (GMD) (Mycobacterium tuberculosis H37Rv)
VKRALITGITGQDGSYLAELLLAKGYEVHGLIRRASTFNTSRIDHLYVDPHQPGARLFLH
YGDLIDGTRLVTLLSTIEPDEVYNLAAQSHVRVSFDEPVHTGDTTGMGSMRLLEAVRLSR
VHCRFYQASSSEMFGASPPPQNELTPFYPRSPYGAAKVYSYWATRNYREAYGLFAVNGIL
FNHESPRRGETFVTRKITRAVARIKAGIQSEVYMGNLDAVRDWGYAPEYVEGMWRMLQTD
EPDDFVLATGRGFTVREFARAAFEHAGLDWQQYVKFDQRYLRPTEVDSLIGDATKAAELL
GWRASVHTDELARIMVDADMAALECEGKPWIDKPMIAGRT