Protein Info for Rv1506c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF08241: Methyltransf_11" amino acids 14 to 63 (50 residues), 30.1 bits, see alignment E=1.3e-10 PF08242: Methyltransf_12" amino acids 14 to 78 (65 residues), 32.8 bits, see alignment E=1.9e-11 PF13649: Methyltransf_25" amino acids 14 to 64 (51 residues), 36.2 bits, see alignment E=1.7e-12 PF13489: Methyltransf_23" amino acids 14 to 116 (103 residues), 28.7 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 99% identical to Y1506_MYCTU: Putative methyltransferase Rv1506c (Rv1506c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mra:MRA_1517)

Predicted SEED Role

"SAM (And some other nucleotide) binding motif"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>Rv1506c Hypothetical protein (Mycobacterium tuberculosis H37Rv)
VRIVNAADPFSINDLGCGYGALLDYLDARGFKTDYTGIDVSPEMVRAAALRFEGRANADF
ICAARIDREADYSVASGIFNVRLKSLDTEWCAHIEATLDMLNAASRRGFSFNCLTSYSDA
SKMRDDLYYADPCALFDLCKRRYSKSVALLHDYGLYEFTILVRKAS