Protein Info for Rv1498c in Mycobacterium tuberculosis H37Rv

Annotation: Probable methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF01209: Ubie_methyltran" amino acids 1 to 118 (118 residues), 29.8 bits, see alignment E=1.1e-10 PF13649: Methyltransf_25" amino acids 1 to 113 (113 residues), 70.7 bits, see alignment E=4.1e-23 PF13489: Methyltransf_23" amino acids 1 to 127 (127 residues), 49.7 bits, see alignment E=1.1e-16 PF13847: Methyltransf_31" amino acids 1 to 136 (136 residues), 71 bits, see alignment E=3e-23 PF08242: Methyltransf_12" amino acids 2 to 115 (114 residues), 56.6 bits, see alignment E=1.1e-18 PF08241: Methyltransf_11" amino acids 2 to 117 (116 residues), 72.7 bits, see alignment E=9.5e-24

Best Hits

KEGG orthology group: None (inferred from 98% identity to mtc:MT1546)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>Rv1498c Probable methyltransferase (Mycobacterium tuberculosis H37Rv)
VLDVGCGSGRMALPLTGYLNSEGRYAGFDISQKAIAWCQEHITSAHPNFQFEVSDIYNSL
YNPKGKYQSLDFRFPYPDASFDVVFLTSVFTHMFPPDVEHYLDEISRVLKPGGRCLCTYF
LLNDESLAHIAEGKSAHNFQHEGPGYRTIHKKRPEEAIGLPETFVRDVYGKFGLAVHEPL
HYGSWSGREPRLSFQDIVIATKTAS