Protein Info for Rv1490 in Mycobacterium tuberculosis H37Rv

Annotation: Probable membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 157 to 173 (17 residues), see Phobius details amino acids 180 to 196 (17 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 381 to 398 (18 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to Y1527_MYCBO: Uncharacterized protein Mb1527 (BQ2027_MB1527) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1490)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>Rv1490 Probable membrane protein (Mycobacterium tuberculosis H37Rv)
VSQCFAVKGIGGADQATLGSAEILVKYAQLADKRARVYVLVSTWLVVWGIWHVYFVEAVF
PNAILWLHYYAASYEFGFVRRGLGGELIRMLTGDHFFAGAYTVLWTSITVWLIALAVVVW
LILSTGNRSERRIMLALLVPVLPFAFSYAIYNPHPELFGMTALVAFSIFLTRAHTSRTRV
ILSTLYGLTMAVLALIHEAIPLEFALGAVLAIIVLSKNATGATRRICTALAIGPGTVSVL
LLAVVGRRDIADQLCAHIPHGMVENPWAVATTPQRVLDYIFGRVESHADYHDWVCEHVTP
WFNLDWITSAKLVAVVGFRALFGAFLLGLLFFVATTSMIRYVSAVPVRTFFAELRGNLAL
PVLASALLVPLFITAVDWTRWWVMITLDVAIVYILYAIDRPEIEQPPSRRNVQVFVCVVL
VLAVIPTGSANNIGR