Protein Info for Rv1487 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details PF01957: NfeD" amino acids 53 to 140 (88 residues), 68.6 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1523)

Predicted SEED Role

"Putative activity regulator of membrane protease YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>Rv1487 Conserved membrane protein (Mycobacterium tuberculosis H37Rv)
MPVALIWLIAALVLVGAEALTGDMFLLMLGGGALAASVSSWLLAWPMWADGAVFLLVSVL
LLVLVRPAVRRRLTQTKGVQLGIEALEGKKAVVLGRVARDGGQVKLDGQVWTARPLNDGD
VFEPGDSVTVVQIDGATAVVFKDV