Protein Info for Rv1479 in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein MoxR1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF20030: bpMoxR" amino acids 43 to 219 (177 residues), 55.8 bits, see alignment E=6.6e-19 PF07726: AAA_3" amino acids 73 to 203 (131 residues), 202.9 bits, see alignment E=3.1e-64 PF07728: AAA_5" amino acids 73 to 201 (129 residues), 57.9 bits, see alignment E=2.4e-19 PF17863: AAA_lid_2" amino acids 280 to 343 (64 residues), 69.2 bits, see alignment E=4.3e-23

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to mtc:MT1526)

Predicted SEED Role

"COG0714: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>Rv1479 Probable transcriptional regulatory protein MoxR1 (Mycobacterium tuberculosis H37Rv)
MTSAGGFPAGAGGYQTPGGHSASPAHEAPPGGAEGLAAEVHTLERAIFEVKRIIVGQDQL
VERMLVGLLSKGHVLLEGVPGVAKTLAVETFARVVGGTFSRIQFTPDLVPTDIIGTRIYR
QGREEFDTELGPVVANFLLADEINRAPAKVQSALLEVMQERHVSIGGRTFPMPSPFLVMA
TQNPIEHEGVYPLPEAQRDRFLFKINVGYPSPEEEREIIYRMGVTPPQAKQILSTGDLLR
LQEIAANNFVHHALVDYVVRVVFATRKPEQLGMNDVKSWVAFGASPRASLGIIAAARSLA
LVRGRDYVIPQDVIEVIPDVLRHRLVLTYDALADEISPEIVINRVLQTVALPQVNAVPQQ
GHSVPPVMQAAAAASGR