Protein Info for Rv1465 in Mycobacterium tuberculosis H37Rv

Annotation: Possible nitrogen fixation related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR01994: SUF system FeS assembly protein, NifU family" amino acids 5 to 143 (139 residues), 173.8 bits, see alignment E=9.3e-56 PF01592: NifU_N" amino acids 9 to 131 (123 residues), 131 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 99% identity to mtc:MT1512)

Predicted SEED Role

"Putative iron-sulfur cluster assembly scaffold protein for SUF system, SufE2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>Rv1465 Possible nitrogen fixation related protein (Mycobacterium tuberculosis H37Rv)
VTLRLEQIYQDVILDHYKHPQHRGLREPFGAQVYHVNPICGDEVTLRVALSEDGTRVTDV
SYDGQGCSISQAATSVLTEQVIGQRVPRALNIVDAFTEMVSSRGTVPGDEDVLGDGVAFA
GVAKYPARVKCALLGWMAFKDALAQASEAFEEVTDERNQRTG