Protein Info for Rv1463 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01978: FeS assembly ATPase SufC" amino acids 4 to 249 (246 residues), 347.5 bits, see alignment E=1.9e-108 PF00005: ABC_tran" amino acids 26 to 177 (152 residues), 82.2 bits, see alignment E=2.7e-27

Best Hits

Swiss-Prot: 60% identical to SUFC_BACSU: Vegetative protein 296 (sufC) from Bacillus subtilis (strain 168)

KEGG orthology group: K09013, Fe-S cluster assembly ATP-binding protein (inferred from 100% identity to mtb:TBMG_02519)

Predicted SEED Role

"Iron-sulfur cluster assembly ATPase protein SufC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>Rv1463 Probable conserved ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MTILEIKDLHVSVENPAEADHEIPILRGVDLTVKSGETHALMGPNGSGKSTLSYAIAGHP
KYHVTSGTITLDGADVLAMSIDERARAGLFLAMQYPVEVPGVSMSNFLRSAATAIRGEPP
KLRHWVKEVKAAMAALDIDPAFAERSVNEGFSGGEKKRHEILQLELLKPKIAILDETDSG
LDVDALRVVSEGVNRYAESQHGGILLITHYTRILRYIHPEYVHVFVGGRIVESGGSELAD
ELDQNGYVRFSPASGRYPHQPAPTGA