Protein Info for Rv1459c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 322 to 338 (17 residues), see Phobius details amino acids 343 to 360 (18 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 440 to 459 (20 residues), see Phobius details amino acids 468 to 492 (25 residues), see Phobius details amino acids 503 to 522 (20 residues), see Phobius details amino acids 528 to 550 (23 residues), see Phobius details PF26314: MptA_B_family" amino acids 38 to 357 (320 residues), 291.1 bits, see alignment E=7.6e-91 PF27547: MptB_C" amino acids 406 to 481 (76 residues), 101.2 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 100% identical to Y1459_MYCTU: Alpha-(1->6)-mannopyranosyltransferase Rv1459c (Rv1459c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K14339, alpha-1,6-mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to mra:MRA_1468)

Predicted SEED Role

"POSSIBLE CONSERVED INTEGRAL MEMBRANE PROTEIN"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>Rv1459c Possible conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MAARHHTLSWSIASLHGDEQAVGAPLTTTELTALARTRLFGATGTVLMAIGALGAGARPV
VQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWLMLGRFTLGRRRMSRGKLDRTLLL
WMLPLLIAPPMYSKDVYSYLAQSEIGRDGLDPYRVGPASGLGLGHVFTLSVPSLWRETPA
PYGPLFLWIGRGISSLTGENIVAAVLCHRLVVLIGVTLIVWATPRLAQRCGVAEVSALWL
GAANPLLIMHLVAGIHNEALMLGLMLTGVEFALRGLDMANTPRPSPETWRLGPATIRASR
RPELGASPRAGASRAVKPRPEWGPLAMLLAGSILITLSSQVKLPSLLAMGFVTTVLAYRW
GGNLRALLLAAAVMASLTLAIMAILGWASGLGFGWINTLGTANVVRSWMSPPTLLALGTG
HVGILLGLGDHTTAVLSLTRAIGVLIITVMVCWLLLAVLRGRLHPIGGLGVALAVTVLLF
PVVQPWYLLWAIIPLAAWATRPGFRVAAILATLIVGIFGPTANGDRFALFQIVDATAASA
IIVILLIALTYTRLPWRPLAAEQVVTAAESASKTPATRRPTAAPDAYADST