Protein Info for Rv1456c in Mycobacterium tuberculosis H37Rv

Annotation: Probable unidentified antibiotic-transport integral membrane ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details PF02628: COX15-CtaA" amino acids 17 to 291 (275 residues), 38.5 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to mbb:BCG_1517c)

Predicted SEED Role

"Cytochrome oxidase assembly protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>Rv1456c Probable unidentified antibiotic-transport integral membrane ABC transporter (Mycobacterium tuberculosis H37Rv)
VPYDRAVSPSLRVQRVIAAIVILTQGGIAVTGAIVRVTASGLGCPTWPQCFPGSFTPVVV
AEVPRVHQAVEFGNRMVTFAVVIAAALAVLVVTRARRRTEVLAYAWLMPVSTVVQAMIGG
ITVRTGLLWWTVAIHLLASMTMVWLAVLLYVKIGQPDDGVVHELVVSPLRALTALSALNL
AAVLVTGTLVTAAGPHAGDRSPSRTVPRLKVEITTLVHMHSSLLVAYLALLIGLGFGLLA
VGATRAILVRLAVLLALVATQAAVGTTQYFTGVPAALVAIHVAGAAAVTAATAALWASMG
ERAQPQPLQR