Protein Info for Rv1422 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01826: conserved hypothetical protein" amino acids 5 to 311 (307 residues), 350.7 bits, see alignment E=4.3e-109 PF01933: CofD" amino acids 5 to 283 (279 residues), 247 bits, see alignment E=1.2e-77

Best Hits

Swiss-Prot: 100% identical to GNGF_MYCTO: Putative gluconeogenesis factor (MT1465) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1457)

Predicted SEED Role

"FIG002813: LPPG:FO 2-phospho-L-lactate transferase like, CofD-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>Rv1422 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MTDGIVALGGGHGLYATLSAARRLTPYVTAVVTVADDGGSSGRLRSELDVVPPGDLRMAL
AALASDSPHGRLWATILQHRFGGSGALAGHPIGNLMLAGLSEVLADPVAALDELGRILGV
KGRVLPMCPVALQIEADVSGLEADPRMFRLIRGQVAIATTPGKVRRVRLLPTDPPATRQA
VDAIMAADLVVLGPGSWFTSVIPHVLVPGLAAALRATSARRALVLNLVAEPGETAGFSVE
RHLHVLAQHAPGFTVHDIIIDAERVPSEREREQLRRTATMLQAEVHFADVARPGTPLHDP
GKLAAVLDGVCARDVGASEPPVAATQEIPIDGGRPRGDDAWR