Protein Info for Rv1420 in Mycobacterium tuberculosis H37Rv

Annotation: Probable excinuclease ABC (subunit C-nuclease) UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 TIGR00194: excinuclease ABC subunit C" amino acids 13 to 618 (606 residues), 497.8 bits, see alignment E=2.4e-153 PF01541: GIY-YIG" amino acids 18 to 91 (74 residues), 38.4 bits, see alignment E=3.7e-13 PF02151: UVR" amino acids 210 to 242 (33 residues), 35.5 bits, see alignment (E = 1.9e-12) PF08459: UvrC_RNaseH_dom" amino acids 403 to 571 (169 residues), 163.1 bits, see alignment E=1.4e-51 PF14520: HHH_5" amino acids 586 to 638 (53 residues), 41.6 bits, see alignment 4.3e-14 PF12826: HHH_2" amino acids 590 to 635 (46 residues), 34.3 bits, see alignment 6.7e-12 PF00633: HHH" amino acids 609 to 635 (27 residues), 27.4 bits, see alignment (E = 6.7e-10)

Best Hits

Swiss-Prot: 100% identical to UVRC_MYCTO: UvrABC system protein C (uvrC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to mra:MRA_1429)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>Rv1420 Probable excinuclease ABC (subunit C-nuclease) UvrC (Mycobacterium tuberculosis H37Rv)
VPDPATYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQL
VTTAAKVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVY
RGPRRKGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCS
APCIGRVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSAL
KRAMEKQAVVLGDGTDADVVAFADDELEAAVQVFHVRGGRVRGQRGWIVEKPGEPGDSGI
QLVEQFLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRV
PRRGDKRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDV
SHVQGTDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ
SDPDLLSPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRLEEVWV
PSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGEHRRKA
LVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSGAAR