Protein Info for Rv1416 in Mycobacterium tuberculosis H37Rv

Annotation: Probable riboflavin synthase beta chain RibH (6,7-dimethyl-8-ribityllumazine synthase) (DMRL synthase) (lumazine synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 18 to 150 (133 residues), 132.8 bits, see alignment E=4.4e-43 PF00885: DMRL_synthase" amino acids 18 to 152 (135 residues), 165.7 bits, see alignment E=2.9e-53

Best Hits

Swiss-Prot: 99% identical to RISB_MYCBO: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 99% identity to mtc:MT1459)

MetaCyc: 37% identical to 6,7-dimethyl-8-ribityllumazine synthase monomer (Bacillus subtilis)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>Rv1416 Probable riboflavin synthase beta chain RibH (6,7-dimethyl-8-ribityllumazine synthase) (DMRL synthase) (lumazine synthase) (Mycobacterium tuberculosis H37Rv)
VKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAI
EIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTN
TEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS