Protein Info for Rv1411c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved lipoprotein LprG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07161: LppX_LprAFG" amino acids 40 to 230 (191 residues), 271.8 bits, see alignment E=1.8e-85

Best Hits

Swiss-Prot: 100% identical to LPRG_MYCBO: Lipoarabinomannan carrier protein LprG (lprG) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K14954, lipoprotein LprG (inferred from 100% identity to mtu:Rv1411c)

Predicted SEED Role

"Glycolipoprotein LprG, antigen P27 modulating immune response against mycobacteria in favour of bacterial persistence"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>Rv1411c Conserved lipoprotein LprG (Mycobacterium tuberculosis H37Rv)
MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHM
VLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQW
SDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQI
APPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS