Protein Info for Rv1409 in Mycobacterium tuberculosis H37Rv

Annotation: Probable bifunctional riboflavin biosynthesis protein RibG : diaminohydroxyphosphoribosylaminopyrimidine deaminase (riboflavin-specific deaminase) + 5-amino-6-(5-phosphoribosylamino) uracil reductase (HTP reductase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00383: dCMP_cyt_deam_1" amino acids 10 to 106 (97 residues), 62.4 bits, see alignment E=4.9e-21 TIGR00326: riboflavin biosynthesis protein RibD" amino acids 13 to 334 (322 residues), 309.6 bits, see alignment E=2.9e-96 PF14437: MafB19-deam" amino acids 27 to 113 (87 residues), 31.8 bits, see alignment E=1.8e-11 PF01872: RibD_C" amino acids 154 to 334 (181 residues), 178.7 bits, see alignment E=1.9e-56

Best Hits

Swiss-Prot: 100% identical to RIBD_MYCTO: Riboflavin biosynthesis protein RibD (ribD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K11752, diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC: 1.1.1.193 3.5.4.26] (inferred from 99% identity to mbt:JTY_1445)

Predicted SEED Role

"Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193, EC 3.5.4.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.193

Use Curated BLAST to search for 1.1.1.193 or 3.5.4.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>Rv1409 Probable bifunctional riboflavin biosynthesis protein RibG : diaminohydroxyphosphoribosylaminopyrimidine deaminase (riboflavin-specific deaminase) + 5-amino-6-(5-phosphoribosylamino) uracil reductase (HTP reductase) (Mycobacterium tuberculosis H37Rv)
MNVEQVKSIDEAMGLAIEHSYQVKGTTYPKPPVGAVIVDPNGRIVGAGGTEPAGGDHAEV
VALRRAGGLAAGAIVVVTMEPCNHYGKTPPCVNALIEARVGTVVYAVADPNGIAGGGAGR
LSAAGLQVRSGVLAEQVAAGPLREWLHKQRTGLPHVTWKYATSIDGRSAAADGSSQWISS
EAARLDLHRRRAIADAILVGTGTVLADDPALTARLADGSLAPQQPLRVVVGKRDIPPEAR
VLNDEARTMMIRTHEPMEVLRALSDRTDVLLEGGPTLAGAFLRAGAINRILAYVAPILLG
GPVTAVDDVGVSNITNALRWQFDSVEKVGPDLLLSLVAR