Protein Info for Rv1407 in Mycobacterium tuberculosis H37Rv

Annotation: Probable Fmu protein (sun protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF01029: NusB" amino acids 15 to 137 (123 residues), 91.6 bits, see alignment E=5.7e-30 PF01189: Methyltr_RsmB-F" amino acids 260 to 454 (195 residues), 226 bits, see alignment E=3.7e-71

Best Hits

Swiss-Prot: 100% identical to Y1407_MYCTU: Putative methyltransferase Rv1407 (Rv1407) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to mbb:BCG_1468)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>Rv1407 Probable Fmu protein (sun protein) (Mycobacterium tuberculosis H37Rv)
MTPRSRGPRRRPLDPARRAAFETLRAVSARDAYANLVLPALLAQRGIGGRDAAFATELTY
GTCRARGLLDAVIGAAAERSPQAIDPVLLDLLRLGTYQLLRTRVDAHAAVSTTVEQAGIE
FDSARAGFVNGVLRTIAGRDERSWVGELAPDAQNDPIGHAAFVHAHPRWIAQAFADALGA
AVGELEAVLASDDERPAVHLAARPGVLTAGELARAVRGTVGRYSPFAVYLPRGDPGRLAP
VRDGQALVQDEGSQLVARALTLAPVDGDTGRWLDLCAGPGGKTALLAGLGLQCAARVTAV
EPSPHRADLVAQNTRGLPVELLRVDGRHTDLDPGFDRVLVDAPCTGLGALRRRPEARWRR
QPADVAALAKLQRELLSAAIALTRPGGVVLYATCSPHLAETVGAVADALRRHPVHALDTR
PLFEPVIAGLGEGPHVQLWPHRHGTDAMFAAALRRLT