Protein Info for Rv1402 in Mycobacterium tuberculosis H37Rv

Annotation: Putative primosomal protein N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 PF17764: PriA_3primeBD" amino acids 2 to 96 (95 residues), 63.6 bits, see alignment E=6.1e-22

Best Hits

Swiss-Prot: 100% identical to PRIA_MYCTU: Probable primosomal protein N' (priA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to mra:MRA_1411)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>Rv1402 Putative primosomal protein N (Mycobacterium tuberculosis H37Rv)
MLSVPHLDRDFDYLVPAEHSDDAQPGVRVRVRFHGRLVDGFVLERRSDSDHHGKLGWLDR
VVSPEPVLTTEIRRLVDAVAARYAGTRQDVLRLAVPARHARVEREITTAPGRPVVAPVDP
SGWAAYGRGRQFLAALADSRAARAVWQALPGELWADRFAEAAAQTVRAGRTVLAIVPDQR
DLDTLWQAATALVDEHSVVALSAGLGPEARYRRWLAALRGSARLVIGTRSAVFAPLSELG
LVMVWADADDSLAEPRAPYPHAREVAMLRAHQARCAALIGGYARTAEAHALVRSGWAHDV
VAPRPEVRARSPRVVALDDSGYDDARDPAARTARLPSIALRAARSALQSGAPVLVQVPRR
GYIPSLACGRCRAIARCRSCTGPLSLQGAGSPGAVCRWCGRVDPTLRCVRCGSDVVRAVV
VGARRTAEELGRAFPGTAVITSAGDTLVPQLDAGPALVVATPGAEPRAPGGYGAALLLDS
WALLGRQDLRAAEDALWRWMTAAALVRPRGAGGVVTVVAESSIPTVQSLIRWDPVGHAEA
ELAARTEVGLPPSVHIAALDGPAGTVTALLEAARLPDPDRLQADLLGPVDLPPGVRRPAG
IPADAPVIRMLLRVCREQGLELAASLRRGIGVLSARQTRQTRSLVRVQIDPLHIG