Protein Info for Rv1401 in Mycobacterium tuberculosis H37Rv

Annotation: Possible membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 48 to 73 (26 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF07947: YhhN" amino acids 3 to 183 (181 residues), 167.5 bits, see alignment E=1.3e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1436)

Predicted SEED Role

"YhhN family membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>Rv1401 Possible membrane protein (Mycobacterium tuberculosis H37Rv)
MLQPAFKASMAVLLAAAAVAHPIGRERRWLVPALLLSATGDWLLAIPWWTWAFVFGLGAF
LLAHLCFIGALLPLARQAAPSRGRVAAVVAMCVASAGLLVWFWPHLGKDNLTIPVTVYIV
ALSAMVCTALLARLPTIWTAVGAVCFAASDSMIGIGRFILGNEALAVPIWWSYAAAEILI
TAGFFFGREVPDNAAAPTDS