Protein Info for Rv1399c in Mycobacterium tuberculosis H37Rv

Annotation: Probable non lipolytic carboxylesterase NlhH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF00135: COesterase" amino acids 71 to 168 (98 residues), 54.9 bits, see alignment E=1.2e-18 PF20434: BD-FAE" amino acids 71 to 175 (105 residues), 80.7 bits, see alignment E=1.7e-26 PF07859: Abhydrolase_3" amino acids 84 to 293 (210 residues), 245 bits, see alignment E=1e-76

Best Hits

Swiss-Prot: 100% identical to NLHH_MYCTU: Carboxylesterase NlhH (nlhH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to mbb:BCG_1460c)

Predicted SEED Role

"Esterase/lipase"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>Rv1399c Probable non lipolytic carboxylesterase NlhH (Mycobacterium tuberculosis H37Rv)
MTEPTVARPDIDPVLKMLLDTFPVTFTAADGVEVARARLRQLKTPPELLPELRIEERTVG
YDGLTDIPVRVYWPPVVRDNLPVVVYYHGGGWSLGGLDTHDPVARAHAVGAQAIVVSVDY
RLAPEHPYPAGIDDSWAALRWVGENAAELGGDPSRIAVAGDSAGGNISAVMAQLARDVGG
PPLVFQLLWYPTTMADLSLPSFTENADAPILDRDVIDAFLAWYVPGLDISDHTMLPTTLA
PGNADLSGLPPAFIGTAEHDPLRDDGACYAELLTAAGVSVELSNEPTMVHGYVNFALVVP
AAAEATGRGLAALKRALHA