Protein Info for Rv1377c in Mycobacterium tuberculosis H37Rv

Annotation: Putative transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 46 to 116 (71 residues), 27.4 bits, E=1.2e-09
• PF13489: Methyltransf_23
  • amino acids 46 to 154 (109 residues), 41.4 bits, E=6.5e-14
• PF03848: TehB
  • amino acids 47 to 149 (103 residues), 30.1 bits, E=1.6e-10
• PF01209: Ubie_methyltran
  • amino acids 48 to 152 (105 residues), 30.9 bits, E=8.7e-11
• PF13847: Methyltransf_31
  • amino acids 48 to 151 (104 residues), 57.8 bits, E=5.5e-19
• PF13649: Methyltransf_25
  • amino acids 49 to 142 (94 residues), 79.4 bits, E=1.4e-25
• PF02353: CMAS
  • amino acids 49 to 152 (104 residues), 32.7 bits, E=2.6e-11
• PF08241: Methyltransf_11
  • amino acids 50 to 146 (97 residues), 66.2 bits, E=1.8e-21
• PF08242: Methyltransf_12
  • amino acids 50 to 145 (96 residues), 57.4 bits, E=9.9e-19
• PF05724: TPMT
  • amino acids 52 to 189 (138 residues), 35.2 bits, E=5.5e-12

Best Hits

KEGG orthology group: K01043, [EC: 2.-.-.-] (inferred from 100% identity to mtc:MT1421)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Lipopolysaccharide biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-, 2.1.1.-

Use Curated BLAST to search for 2.-.-.- or 2.1.1.-

Protein Sequence (212 amino acids)

>Rv1377c Putative transferase (Mycobacterium tuberculosis H37Rv)
MPGIDFDALYRGESPGEGLPPITTPPWDTKAPKDNVIGWHTGGWVHGDVLDIGCGLGDNA
IYLARNGYQVTGLDISPTALTTAKRRASDAGVDVKFAVGDATKLTGYTGAFDTVIDCGMF
HCLDDDGKRSYAASVHRATRPGATLLLSCFSNAMPPDEEWPRSTVSEQTLRDVLGGAGWD
IESLEPATVRRELDGTEVEMAFWNVRAQRRGS