Protein Info for Rv1377c in Mycobacterium tuberculosis H37Rv

Annotation: Putative transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF05175: MTS" amino acids 46 to 120 (75 residues), 29.9 bits, see alignment E=2.1e-10 PF03848: TehB" amino acids 47 to 149 (103 residues), 30.1 bits, see alignment E=1.6e-10 PF13489: Methyltransf_23" amino acids 47 to 154 (108 residues), 37.3 bits, see alignment E=1.2e-12 PF13847: Methyltransf_31" amino acids 48 to 151 (104 residues), 58.2 bits, see alignment E=4.1e-19 PF01209: Ubie_methyltran" amino acids 48 to 152 (105 residues), 30.9 bits, see alignment E=8.7e-11 PF13649: Methyltransf_25" amino acids 49 to 142 (94 residues), 79.6 bits, see alignment E=1.2e-25 PF02353: CMAS" amino acids 49 to 152 (104 residues), 32.7 bits, see alignment E=2.6e-11 PF08242: Methyltransf_12" amino acids 50 to 145 (96 residues), 57.5 bits, see alignment E=9.3e-19 PF08241: Methyltransf_11" amino acids 50 to 146 (97 residues), 66.2 bits, see alignment E=1.8e-21 PF05724: TPMT" amino acids 52 to 189 (138 residues), 35.2 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: K01043, [EC: 2.-.-.-] (inferred from 100% identity to mtc:MT1421)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-, 2.1.1.-

Use Curated BLAST to search for 2.-.-.- or 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>Rv1377c Putative transferase (Mycobacterium tuberculosis H37Rv)
MPGIDFDALYRGESPGEGLPPITTPPWDTKAPKDNVIGWHTGGWVHGDVLDIGCGLGDNA
IYLARNGYQVTGLDISPTALTTAKRRASDAGVDVKFAVGDATKLTGYTGAFDTVIDCGMF
HCLDDDGKRSYAASVHRATRPGATLLLSCFSNAMPPDEEWPRSTVSEQTLRDVLGGAGWD
IESLEPATVRRELDGTEVEMAFWNVRAQRRGS