Protein Info for Rv1370c in Mycobacterium tuberculosis H37Rv

Annotation: Putative transposase for insertion sequence element IS6110 (fragment)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF01527: HTH_Tnp_1" amino acids 7 to 83 (77 residues), 35.2 bits, see alignment E=6.1e-13

Best Hits

Swiss-Prot: 100% identical to YIA4_MYCTA: Insertion element IS6110 uncharacterized 12.0 kDa protein (MRA_0012) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K07483, transposase (inferred from 100% identity to mtc:MT3099)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>Rv1370c Putative transposase for insertion sequence element IS6110 (fragment) (Mycobacterium tuberculosis H37Rv)
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVD
AGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR