Protein Info for Rv1365c in Mycobacterium tuberculosis H37Rv

Annotation: Anti-anti-sigma factor RsfA (anti-sigma factor antagonist) (regulator of sigma F A)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00377: anti-anti-sigma factor
  • amino acids 16 to 122 (107 residues), 120.6 bits, E=1.3e-39
• PF13466: STAS_2
  • amino acids 20 to 115 (96 residues), 41.2 bits, E=1.7e-14
• PF01740: STAS
  • amino acids 20 to 124 (105 residues), 84.1 bits, E=5.4e-28

Best Hits

Swiss-Prot: 100% identical to RSFA_MYCTO: Anti-sigma-F factor antagonist RsfA (rsfA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_1427c)

Predicted SEED Role

"Anti-sigma F factor antagonist (spoIIAA-2); Anti-sigma B factor antagonist RsbV"

Protein Sequence (128 amino acids)

>Rv1365c Anti-anti-sigma factor RsfA (anti-sigma factor antagonist) (regulator of sigma F A) (Mycobacterium tuberculosis H37Rv)
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEP
LVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPT
TESALSAT