Protein Info for Rv1364c in Mycobacterium tuberculosis H37Rv

Annotation: Possible sigma factor regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 TIGR00229: PAS domain S-box protein" amino acids 18 to 139 (122 residues), 29.2 bits, see alignment E=4.3e-11 PF08448: PAS_4" amino acids 21 to 135 (115 residues), 44.9 bits, see alignment E=3.1e-15 PF07228: SpoIIE" amino acids 203 to 396 (194 residues), 141.9 bits, see alignment E=6e-45 PF13581: HATPase_c_2" amino acids 409 to 522 (114 residues), 60.6 bits, see alignment E=3.8e-20 PF13466: STAS_2" amino acids 559 to 628 (70 residues), 36 bits, see alignment E=1.6e-12 PF01740: STAS" amino acids 560 to 632 (73 residues), 49.5 bits, see alignment E=8.1e-17

Best Hits

Swiss-Prot: 100% identical to Y1364_MYCTU: Uncharacterized protein Rv1364c (Rv1364c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_11395)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (653 amino acids)

>Rv1364c Possible sigma factor regulatory protein (Mycobacterium tuberculosis H37Rv)
MAAEMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAR
EVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDYDGSGVEERYFDFVVTPRRRADGSI
EGVQLIVDDVTSRVRARQAAEARVEELSERYRNVRDSATVMQQALLAASVPVVPGADIAA
EYLVAAEDTAAGGDWFDALALGDRLVLVVGDVVGHGVEAAAVMSQLRTALRMQISAGYTV
VEALEAVDRFHKQVPGSKSATMCVGSLDFTSGEFQYCTAGHPPPLLVTADASARYVEPTG
AGPLGSGTGFPVRSEVLNIGDAILFYTDGLIERPGRPLEASTAEFADLAASIASGSGGFV
LDAPARPIDRLCSDTLELLLRSTGYNDDVTLLAMQRRAPTPPLHITLDATINAARTVRAQ
LREWLAEIGADHSDIADIVHAISEFVENAVEHGYATDVSKGIVVAAALAGDGNVRASVID
RGQWKDHRDGARGRGRGLAMAEALVSEARIMHGAGGTTATLTHRLSRPARFVTDTMVRRA
AFQQTIDSEFVSLVESGRIVVRGDVDSTTAATLDRQIAVESRSGIAPVTIDLSAVTHLGS
AGVGALAAACDRARKQGTECVLVAPPGSPAHHVLSLVQLPVVGADTEDIFAQE