Protein Info for Rv1350 in Mycobacterium tuberculosis H37Rv

Annotation: Probable 3-oxoacyl-[acyl-carrier protein] reductase FabG2 (3-ketoacyl-acyl carrier protein reductase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 9 to 186 (178 residues), 72.8 bits, E=5.3e-24
• PF00106: adh_short
  • amino acids 9 to 197 (189 residues), 191.3 bits, E=2e-60
• PF13561: adh_short_C2
  • amino acids 16 to 244 (229 residues), 214.9 bits, E=2e-67

Best Hits

Swiss-Prot: 100% identical to Y1385_MYCBO: Uncharacterized oxidoreductase Mb1385 (fabG2) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to mbb:BCG_1412)

MetaCyc: 40% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• mycolate biosynthesis (165/205 steps found)
• superpathway of fatty acid biosynthesis II (plant) (34/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (24/31 steps found)
• biotin biosynthesis I (12/15 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (39/53 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• gondoate biosynthesis (anaerobic) (3/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• stearate biosynthesis IV (4/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (6/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (11/16 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• cis-vaccenate biosynthesis (3/5 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• oleate biosynthesis IV (anaerobic) (9/14 steps found)
• (5Z)-dodecenoate biosynthesis I (3/6 steps found)
• (5Z)-dodecenoate biosynthesis II (3/6 steps found)
• superpathway of 2,3-butanediol biosynthesis (3/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (12/20 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (6/12 steps found)
• 2-allylmalonyl-CoA biosynthesis (1/8 steps found)
• palmitate biosynthesis III (16/29 steps found)
• superpathway of mycolate biosynthesis (166/239 steps found)
• tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
• anteiso-branched-chain fatty acid biosynthesis (18/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• streptorubin B biosynthesis (15/34 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.304

Protein Sequence (247 amino acids)

>Rv1350 Probable 3-oxoacyl-[acyl-carrier protein] reductase FabG2 (3-ketoacyl-acyl carrier protein reductase) (Mycobacterium tuberculosis H37Rv)
MASLLNARTAVITGGAQGLGLAIGQRFVAEGARVVLGDVNLEATEVAAKRLGGDDVALAV
RCDVTQADDVDILIRTAVERFGGLDVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWN
GTRLAAAIMRERKRGAIVNMSSVSGKVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRV
NAIAPGLIRSAMTEAMPQRIWDQKLAEVPMGRAGEPSEVASVAVFLASDLSSYMTGTVLD
VTGGRFI