Protein Info for Rv1345 in Mycobacterium tuberculosis H37Rv

Annotation: Probable fatty acyl-AMP ligase MbtM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 207 to 224 (18 residues), see Phobius details PF00501: AMP-binding" amino acids 29 to 384 (356 residues), 127.1 bits, see alignment E=4e-41

Best Hits

Swiss-Prot: 100% identical to MBTM_MYCBO: Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM (mbtM) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01909, long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC: 6.2.1.20] (inferred from 100% identity to mtf:TBFG_11375)

MetaCyc: 100% identical to long-chain fatty acyl-[acyl-carrier protein] ligase MbtM (Mycobacterium tuberculosis H37Rv)
Long-chain-fatty-acid--[acyl-carrier-protein] ligase. [EC: 6.2.1.20]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>Rv1345 Probable fatty acyl-AMP ligase MbtM (Mycobacterium tuberculosis H37Rv)
MSELAAVLTRSMQASAGDLMVLDRETSLWCRHPWPEVHGLAESVAAWLLDHDRPAAVGLV
GEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADATLTRFLGIGVRTVLSQGSYLA
RLRSVDTAGVTIGDLSTAAHTNRSATPVASEGPAVLQGTAGSTGAPRTAILSPGAVLSNL
RGLNQRVGTDAATDVGCSWLPLYHDMGLAFVLSAALAGAPLWLAPTTAFTASPFRWLSWL
SDSGATMTAAPNFAYNLIGKYARRVSEVDLGALRVTLNGGEPVDCDGLTRFAEAMAPFGF
DAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPGMEVRISCGDQ
AAGNASREIGEIEIRGASMMAGYLGQQPIDPDDWFATGDLGYLGAGGLVVCGRAKEVISI
AGRNIFPTEVELVAAQVRGVREGAVVALGTGDRSTRPGLVVAAEFRGPDEANARAELIQR
VASECGIVPSDVVFVSPGSLPRTSSGKLRRLAVRRSLEMAD