Protein Info for Rv1344 in Mycobacterium tuberculosis H37Rv

Annotation: Acyl carrier protein (ACP) MbtL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00550: PP-binding" amino acids 33 to 99 (67 residues), 50.9 bits, see alignment E=7.7e-18

Best Hits

KEGG orthology group: K02078, acyl carrier protein (inferred from 100% identity to mra:MRA_1352)

Predicted SEED Role

"acyl carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>Rv1344 Acyl carrier protein (ACP) MbtL (Mycobacterium tuberculosis H37Rv)
MWRYPLSTRLALPNTPGVASFAMTSSPSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVG
LDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRDE