Protein Info for Rv1340 in Mycobacterium tuberculosis H37Rv

Annotation: Probable ribonuclease RphA (RNase PH) (tRNA nucleotidyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR01966: ribonuclease PH" amino acids 4 to 239 (236 residues), 345.8 bits, see alignment E=5e-108 PF01138: RNase_PH" amino acids 12 to 142 (131 residues), 106.2 bits, see alignment E=1.7e-34 PF03725: RNase_PH_C" amino acids 161 to 225 (65 residues), 45.7 bits, see alignment E=5.2e-16

Best Hits

Swiss-Prot: 100% identical to RNPH_MYCBP: Ribonuclease PH (rph) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K00989, ribonuclease PH [EC: 2.7.7.56] (inferred from 99% identity to mbo:Mb1375)

Predicted SEED Role

"Ribonuclease PH (EC 2.7.7.56)" in subsystem Heat shock dnaK gene cluster extended or tRNA processing (EC 2.7.7.56)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>Rv1340 Probable ribonuclease RphA (RNase PH) (tRNA nucleotidyltransferase) (Mycobacterium tuberculosis H37Rv)
VSKREDGRLDHELRPVIITRGFTENPAGSVLIEFGHTKVLCTASVTEGVPRWRKATGLGW
LTAEYAMLPSATHSRSDRESVRGRLSGRTQEISRLIGRSLRACIDLAALGENTIAIDCDV
LQADGGTRTAAITGAYVALADAVTYLSAAGKLSDPRPLSCAIAAVSVGVVDGRIRVDLPY
EEDSRAEVDMNVVATDTGTLVEIQGTGEGATFARSTLDKLLDMALGACDTLFAAQRDALA
LPYPGVLPQGPPPPKAFGT