Protein Info for Rv1336 in Mycobacterium tuberculosis H37Rv

Annotation: Cysteine synthase B CysM (CSASE B) (O-phosphoserine sulfhydrylase B) (O-phosphoserine (thiol)-lyase B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to CYSM_MYCTU: O-phosphoserine sulfhydrylase (cysM) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K12339, cysteine synthase B [EC: 2.5.1.47] (inferred from 100% identity to mbt:JTY_1372)

MetaCyc: 100% identical to CysO-thiocarboxylate-dependent cysteine synthase monomer (Mycobacterium tuberculosis H37Rv)
RXN-14566 [EC: 2.5.1.113]

Predicted SEED Role

"Cysteine synthase B (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
L-cysteine biosynthesis I (2/2 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
L-cysteine biosynthesis V (mycobacteria) (2/4 steps found)
superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.113 or 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>Rv1336 Cysteine synthase B CysM (CSASE B) (O-phosphoserine sulfhydrylase B) (O-phosphoserine (thiol)-lyase B) (Mycobacterium tuberculosis H37Rv)
MTRYDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIE
QAEADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQI
IFSAAEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLPEITHFV
AGLGTTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYALRNMDEGFVPELYDPEILTARY
SVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGWKY
LSTGAYAGSLDDAETALEGQLWA