Protein Info for Rv1334 in Mycobacterium tuberculosis H37Rv

Annotation: Possible hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF14464: Prok-JAB" amino acids 15 to 130 (116 residues), 102.4 bits, see alignment E=6.9e-34

Best Hits

Swiss-Prot: 99% identical to MEC_MYCBO: CysO-cysteine peptidase (mec) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 99% identity to mtb:TBMG_02644)

MetaCyc: 99% identical to [CysO sulfur-carrier protein]-S-L-cysteine hydrolase (Mycobacterium tuberculosis H37Rv)
RXN-14567 [EC: 3.13.1.6]

Predicted SEED Role

"Mov34/MPN/PAD-1 family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.13.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>Rv1334 Possible hydrolase (Mycobacterium tuberculosis H37Rv)
VLLRKGTVYVLVIRADLVNAMVAHARRDHPDEACGVLAGPEGSDRPERHIPMTNAERSPT
FYRLDSGEQLKVWRAMEDADEVPVVIYHSHTATEAYPSRTDVKLATEPDAHYVLVSTRDP
HRHELRSYRIVDGAVTEEPVNVVEQY