Protein Info for Rv1330c in Mycobacterium tuberculosis H37Rv

Annotation: Nicotinic acid phosphoribosyltransferase PncB1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01513: nicotinate phosphoribosyltransferase" amino acids 21 to 436 (416 residues), 476.6 bits, see alignment E=4.1e-147 PF17767: NAPRTase_N" amino acids 22 to 144 (123 residues), 96.9 bits, see alignment E=1.7e-31 PF01729: QRPTase_C" amino acids 149 to 325 (177 residues), 23.4 bits, see alignment E=6.5e-09 PF04095: NAPRTase" amino acids 166 to 362 (197 residues), 26 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 100% identical to PNCB1_MYCTU: Nicotinate phosphoribosyltransferase pncB1 (pncB1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 99% identity to mbo:Mb1365c)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.11

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>Rv1330c Nicotinic acid phosphoribosyltransferase PncB1 (Mycobacterium tuberculosis H37Rv)
VGPPPAARRREGEPDNQDPAGLLTDKYELTMLAAALRDGSANRPTTFEVFARRLPTGRRY
GVVAGTGRLLEALPQFRFDADACELLAQFLDPATVRYLREFRFRGDIDGYAEGELYFPGS
PVLSVRGSFAECVLLETLVLSIFNHDTAIASAAARMVSAAGGRPLIEMGSRRTHERAAVA
AARAAYIAGFAASSNLAAQRRYGVPAHGTAAHAFTMLHAQHGGPTELAERAAFRAQVEAL
GPGTTLLVDTYDVTTGVANAVAAAGAELGAIRIDSGELGVLARQAREQLDRLGATRTRIV
VSGDLDEFSIAALRGEPVDSYGVGTSLVTGSGAPTANMVYKLVEVDGVPVQKRSSYKESP
GGRKEALRRSRATGTITEELVHPAGRPPVIVEPHRVLTLPLVRAGQPVADTSLAAARQLV
ASGLRSLPGDGLKLAPGEPAIPTRTIPA