Protein Info for Rv1327c in Mycobacterium tuberculosis H37Rv

Annotation: Probable glucanase GlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 PF11896: GlgE_dom_N_S" amino acids 16 to 226 (211 residues), 181.2 bits, see alignment E=3.7e-57 PF00128: Alpha-amylase" amino acids 263 to 363 (101 residues), 27.4 bits, see alignment E=3.9e-10 PF21702: GLGE_C" amino acids 600 to 685 (86 residues), 112.2 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 100% identical to GLGE_MYCTU: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase (glgE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01238, [EC: 3.2.1.-] (inferred from 100% identity to mtf:TBFG_11359)

MetaCyc: 100% identical to starch synthase (maltosyl-transferring) monomer (Mycobacterium tuberculosis H37Rv)
RXN-13028 [EC: 2.4.99.16]

Predicted SEED Role

"Putative glucanase glgE (EC 3.2.1.-)" in subsystem Trehalose Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 2.4.99.16 or 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (701 amino acids)

>Rv1327c Probable glucanase GlgE (Mycobacterium tuberculosis H37Rv)
VSGRAIGTETEWWVPGRVEIDDVAPVVSCGVYPAKAVVGEVVPVSAAVWREGHEAVAATL
VVRYLGVRYPHLTDRPRARVLPTPSEPQQRVKPLLIPMTSGQEPFVFHGQFTPDRVGLWT
FRVDGWGDPIHTWRHGLIAKLDAGQGETELSNDLLVGAVLLERAATGVPRGLRDPLLAAA
AALRTPGDPVTRTALALTPEIEELLADYPLRDLVTRGEQFGVWVDRPLARFGAWYEMFPR
STGGWDDDGNPVHGTFATAAAELPRIAGMGFDVVYLPPIHPIGKVHRKGRNNSPTAAPTD
VGSPWAIGSDEGGHDTVHPSLGTIDDFDDFVSAARDLGMEVALDLALQCAPDHPWAREHR
QWFTELPDGTIAYAENPPKKYQDIYPLNFDNDPEGLYDEVLRVVQHWVNHGVKFFRVDNP
HTKPPNFWAWLIAQVKTVDPDVLFLSEAFTPPARQYGLAKLGFTQSYSYFTWRTTKWELT
EFGNQIAELADYRRPNLFVNTPDILHAVLQHNGPGMFAIRAVLAATMSPAWGMYCGYELF
EHRAVREGSEEYLDSEKYELRPRDFASALDQGRSLQPFITRLNIIRRLHPAFQQLRTIHF
HHVDNDALLAYSKFDPATGDCVLVVVTLNAFGPEEATLWLDMAALGMEDYDRFWVRDEIT
GEEYQWGQANYIRIDPARAVAHIINMPAVPYESRNTLLRRR