Protein Info for Rv1315 in Mycobacterium tuberculosis H37Rv

Annotation: Probable UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01072: UDP-N-acetylglucosamine 1-carboxyvinyltransferase" amino acids 3 to 415 (413 residues), 566.5 bits, see alignment E=1.6e-174 PF00275: EPSP_synthase" amino acids 7 to 406 (400 residues), 414 bits, see alignment E=3.1e-128

Best Hits

Swiss-Prot: 100% identical to MURA_MYCTO: UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00790, UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC: 2.5.1.7] (inferred from 100% identity to mtc:MT1355)

MetaCyc: 100% identical to UDP-N-acetylglucosamine enolpyruvyl transferase (Mycobacterium tuberculosis H37Rv)
UDP-N-acetylglucosamine 1-carboxyvinyltransferase. [EC: 2.5.1.7]

Predicted SEED Role

"UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.5.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>Rv1315 Probable UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA (Mycobacterium tuberculosis H37Rv)
VAERFVVTGGNRLSGEVAVGGAKNSVLKLMAATLLAEGTSTITNCPDILDVPLMAEVLRG
LGATVELDGDVARITAPDEPKYDADFAAVRQFRASVCVLGPLVGRCKRARVALPGGDAIG
SRPLDMHQAGLRQLGAHCNIEHGCVVARAETLRGAEIQLEFPSVGATENILMAAVVAEGV
TTIHNAAREPDVVDLCTMLNQMGAQVEGAGSPTMTITGVPRLHPTEHRVIGDRIVAATWG
IAAAMTRGDISVAGVDPAHLQLVLHKLHDAGATVTQTDASFRVTQYERPKAVNVATLPFP
GFPTDLQPMAIALASIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVRGLPQL
SSAPVWCSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYPLFVENLVSLGAEIERVCC