Protein Info for Rv1307 in Mycobacterium tuberculosis H37Rv

Annotation: Probable ATP synthase delta chain AtpH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 23 (17 residues), see Phobius details PF00430: ATP-synt_B" amino acids 3 to 132 (130 residues), 69.6 bits, see alignment E=3e-23 TIGR01144: ATP synthase F0, B subunit" amino acids 7 to 154 (148 residues), 66.2 bits, see alignment E=3e-22 TIGR01145: ATP synthase F1, delta subunit" amino acids 276 to 443 (168 residues), 63 bits, see alignment E=4.1e-21 PF00213: OSCP" amino acids 277 to 441 (165 residues), 98.7 bits, see alignment E=4.3e-32

Best Hits

Swiss-Prot: 100% identical to ATPFD_MYCBP: ATP synthase subunit b-delta (atpFH) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 100% identity to mtc:MT1347)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>Rv1307 Probable ATP synthase delta chain AtpH (Mycobacterium tuberculosis H37Rv)
MSTFIGQLFGFAVIVYLVWRFIVPLVGRLMSARQDTVRQQLADAAAAADRLAEASQAHTK
ALEDAKSEAHRVVEEARTDAERIAEQLEAQADVEAERIKMQGARQVDLIRAQLTRQLRLE
LGHESVRQARELVRNHVADQAQQSATVDRFLDQLDAMAPATADVDYPLLAKMRSASRRAL
TSLVDWFGTMAQDLDHQGLTTLAGELVSVARLLDREAVVTRYLTVPAEDATPRIRLIERL
VSGKVGAPTLEVLRTAVSKRWSANSDLIDAIEHVSRQALLELAERAGQVDEVEDQLFRFS
RILDVQPRLAILLGDCAVPAEGRVRLLRKVLERADSTVNPVVVALLSHTVELLRGQAVEE
AVLFLAEVAVARRGEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTVQLHIDAALLGGL
SIAVGDEVIDGTLSSRLAAAEARLPD