Protein Info for Rv1303 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details PF03899: ATP-synt_I" amino acids 21 to 114 (94 residues), 49.4 bits, see alignment E=2.6e-17

Best Hits

Swiss-Prot: 99% identical to Y1335_MYCBO: Uncharacterized protein Mb1335 (BQ2027_MB1335) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_1363)

Predicted SEED Role

"FIG048548: ATP synthase protein I2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>Rv1303 Conserved hypothetical transmembrane protein (Mycobacterium tuberculosis H37Rv)
VTTPAQDAPLVFPSVAFRPVRLFFINVGLAAVAMLVAGVFGHLTVGMFLGLGLLLGLLNA
LLVRRSAESITAKEHPLKRSMALNSASRLAIITILGLIIAYIFRPAGLGVVFGLAFFQVL
LVATTALPVLKKLRTATEEPVATYSSNGQTGGSEGRSASDD