Protein Info for Rv1302 in Mycobacterium tuberculosis H37Rv

Annotation: Probable undecapaprenyl-phosphate alpha-N-acetylglucosaminyltransferase Rfe (UDP-GlcNAc transferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 111 to 274 (164 residues), 128.7 bits, see alignment E=1e-41

Best Hits

Swiss-Prot: 100% identical to WECA_MYCTO: Decaprenyl-phosphate N-acetylglucosaminephosphotransferase (wecA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1334)

MetaCyc: 100% identical to decaprenol-monophosphate-N-acetylglucosaminyltransferase (Mycobacterium tuberculosis H37Rv)
RXN-6380 [EC: 2.7.8.35]

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>Rv1302 Probable undecapaprenyl-phosphate alpha-N-acetylglucosaminyltransferase Rfe (UDP-GlcNAc transferase) (Mycobacterium tuberculosis H37Rv)
VQYGLEVSSDVAGVAGGLLALSYRGAGVPLRELALVGLTAAIITYFATGPVRMLASRLGA
VAYPRERDVHVTPTPRMGGLAMFLGIVGAVFLASQLPALTRGFVYSTGMPAVLVAGAVIM
GIGLIDDRWGLDALTKFAGQITAASVLVTMGVAWSVLYIPVGGVGTIVLDQASSILLTLA
LTVSIVNAMNFVDGLDGLAAGLGLITALAICMFSVGLLRDHGGDVLYYPPAVISVVLAGA
CLGFLPHNFHRAKIFMGDSGSMLIGLMLAAASTTAAGPISQNAYGARDVFALLSPFLLVV
AVMFVPMLDLLLAIVRRTRAGRSAFSPDKMHLHHRLLQIGHSHRRVVLIIYLWVGIVAFG
AASSIFFNPRDTAAVMLGAIVVAGVATLIPLLRRGDDYYDPDLD