Protein Info for Rv1300 in Mycobacterium tuberculosis H37Rv

Annotation: Probable HemK protein homolog HemK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17827: PrmC_N
  • amino acids 26 to 94 (69 residues), 48.5 bits, E=3.2e-16
• TIGR00536: methyltransferase, HemK family
  • amino acids 75 to 300 (226 residues), 148.6 bits, E=9.7e-48
• PF05175: MTS
  • amino acids 133 to 216 (84 residues), 26.7 bits, E=1.1e-09
• PF13847: Methyltransf_31
  • amino acids 134 to 265 (132 residues), 31.7 bits, E=3.8e-11
• PF13649: Methyltransf_25
  • amino acids 134 to 209 (76 residues), 34.2 bits, E=1.1e-11
• PF08241: Methyltransf_11
  • amino acids 136 to 209 (74 residues), 22.7 bits, E=3.8e-08

Best Hits

Swiss-Prot: 100% identical to PRMC_MYCTU: Release factor glutamine methyltransferase (prmC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to mbb:BCG_1360)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (325 amino acids)

>Rv1300 Probable HemK protein homolog HemK (Mycobacterium tuberculosis H37Rv)
MTSAPATMRWGNLPLAGESGTMTLRQAIDLAAALLAEAGVDSARCDAEQLAAHLAGTDRG
RLPLFEPPGDEFFGRYRDIVTARARRVPLQHLIGTVSFGPVVLHVGPGVFVPRPETEAIL
AWATAQSLPARPLIVDACTGSGALAVALAQHRANLGLKARIIGIDDSDCALDYARRNAAG
TPVELVRADVTTPRLLPELDGQVDLMVSNPPYIPDAAVLEPEVAQHDPHHALFGGPDGMT
VISAVVGLAGRWLRPGGLFAVEHDDTTSSSTVDLVSSTKLFVDVQARKDLAGRPRFVTAM
RWGHLPLAGENGAIDPRQRRCRAKR