Protein Info for Rv1297 in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcription termination factor Rho homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 TIGR00767: transcription termination factor Rho" amino acids 34 to 593 (560 residues), 722.3 bits, see alignment E=8.7e-222 PF07498: Rho_N" amino acids 37 to 71 (35 residues), 40 bits, see alignment (E = 4.8e-14) PF07497: Rho_RNA_bind" amino acids 226 to 303 (78 residues), 84.6 bits, see alignment E=5.1e-28 PF00006: ATP-synt_ab" amino acids 334 to 538 (205 residues), 101.1 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to RHO_MYCTU: Transcription termination factor Rho (rho) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03628, transcription termination factor Rho (inferred from 100% identity to mra:MRA_1305)

Predicted SEED Role

"Transcription termination factor Rho" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>Rv1297 Probable transcription termination factor Rho homolog (Mycobacterium tuberculosis H37Rv)
VTDTDLITAGESTDGKPSDAAATDPPDLNADEPAGSLATMVLPELRALANRAGVKGTSGM
RKNELIAAIEEIRRQANGAPAVDRSAQEHDKGDRPPSSEAPATQGEQTPTEQIDSQSQQV
RPERRSATREAGPSGSGERAGTAADDTDNRQGGQQDAKTEERGTDAGGDQGGDQQASGGQ
QARGDEDGEARQGRRGRRFRDRRRRGERSGDGAEAELREDDVVQPVAGILDVLDNYAFVR
TSGYLPGPHDVYVSMNMVRKNGMRRGDAVTGAVRVPKEGEQPNQRQKFNPLVRLDSINGG
SVEDAKKRPEFGKLTPLYPNQRLRLETSTERLTTRVIDLIMPIGKGQRALIVSPPKAGKT
TILQDIANAITRNNPECHLMVVLVDERPEEVTDMQRSVKGEVIASTFDRPPSDHTSVAEL
AIERAKRLVEQGKDVVVLLDSITRLGRAYNNASPASGRILSGGVDSTALYPPKRFLGAAR
NIEEGGSLTIIATAMVETGSTGDTVIFEEFKGTGNAELKLDRKIAERRVFPAVDVNPSGT
RKDELLLSPDEFAIVHKLRRVLSGLDSHQAIDLLMSQLRKTKNNYEFLVQVSKTTPGSMD
SD