Protein Info for Rv1296 in Mycobacterium tuberculosis H37Rv

Annotation: Probable homoserine kinase ThrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 17 to 281 (265 residues), 195.5 bits, E=4.9e-62
• PF00288: GHMP_kinases_N
  • amino acids 69 to 154 (86 residues), 53 bits, E=3.4e-18
• PF08544: GHMP_kinases_C
  • amino acids 231 to 283 (53 residues), 25.8 bits, 1.1e-09

Best Hits

Swiss-Prot: 100% identical to KHSE_MYCTO: Homoserine kinase (thrB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 100% identity to mtu:Rv1296)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Protein Sequence (316 amino acids)

>Rv1296 Probable homoserine kinase ThrB (Mycobacterium tuberculosis H37Rv)
MVTQALLPSGLVASAVVAASSANLGPGFDSVGLALSLYDEIIVETTDSGLTVTVDGEGGD
QVPLGPEHLVVRAVQHGLQAAGVSAAGLAVRCRNAIPHSRGLGSSAAAVVGGLAAVNGLV
VQTDSSPSSDAELIQLASEFEGHPDNAAAAVLGGAVVSWTDHSGDRPNYSAVSLRLHPDI
RLFTAIPEQRSSTAETRVLLPAQVSHDDARFNVSRAALLVVALTERPDLLMAATEDLLHQ
PQRAAAMTASAEYLRLLRRHNVAAALSGAGPSLIALSTDSELPTDAVEFGAAKGFAVTEL
TVGEAVRWSPTVRVPG