Protein Info for Rv1292 in Mycobacterium tuberculosis H37Rv

Annotation: Probable arginyl-tRNA synthetase ArgS (ARGRS) (arginine--tRNA ligase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 PF03485: Arg_tRNA_synt_N" amino acids 12 to 93 (82 residues), 81.2 bits, see alignment E=1.7e-26 TIGR00456: arginine--tRNA ligase" amino acids 14 to 550 (537 residues), 409.5 bits, see alignment E=9.9e-127 PF00750: tRNA-synt_1d" amino acids 120 to 390 (271 residues), 61.4 bits, see alignment E=1.9e-20 PF00133: tRNA-synt_1" amino acids 327 to 412 (86 residues), 23 bits, see alignment E=8.2e-09 PF05746: DALR_1" amino acids 429 to 550 (122 residues), 122.4 bits, see alignment E=2.7e-39

Best Hits

Swiss-Prot: 100% identical to SYR_MYCTU: Arginine--tRNA ligase (argS) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to mbo:Mb1324)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>Rv1292 Probable arginyl-tRNA synthetase ArgS (ARGRS) (arginine--tRNA ligase) (Mycobacterium tuberculosis H37Rv)
VTPADLAELLKATAAAVLAERGLDASALPQMVTVERPRIPEHGDYASNLAMQLAKKVGTN
PRELAGWLAEALTKVDGIASAEVAGPGFINMRLETAAQAKVVTSVIDAGHSYGHSLLLAG
RKVNLEFVSANPTGPIHIGGTRWAAVGDALGRLLTTQGADVVREYYFNDHGAQIDRFANS
LIAAAKGEPTPQDGYAGSYITNIAEQVLQKAPDALSLPDAELRETFRAIGVDLMFDHIKQ
SLHEFGTDFDVYTHEDSMHTGGRVENAIARLRETGNIYEKDGATWLRTSAFGDDKDRVVI
KSDGKPAYIAGDLAYYLDKRQRGFDLCIYMLGADHHGYIARLKAAAAAFGDDPATVEVLI
GQMVNLVRDGQPVRMSKRAGTVLTLDDLVEAIGVDAARYSLIRSSVDTAIDIDLALWSSA
SNENPVYYVQYAHARLSALARNAAELALIPDTNHLELLNHDKEGTLLRTLGEFPRVLETA
ASLREPHRVCRYLEDLAGDYHRFYDSCRVLPQGDEQPTDLHTARLALCQATRQVIANGLA
IIGVTAPERM