Protein Info for Rv1283c in Mycobacterium tuberculosis H37Rv

Annotation: Probable oligopeptide-transport integral membrane protein ABC transporter OppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 292 to 318 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 26.8 bits, see alignment E=4.9e-10 PF00528: BPD_transp_1" amino acids 113 to 323 (211 residues), 125.4 bits, see alignment E=2.2e-40

Best Hits

Swiss-Prot: 100% identical to Y1283_MYCTU: Putative peptide transport permease protein Rv1283c (Rv1283c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to mra:MRA_1291)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>Rv1283c Probable oligopeptide-transport integral membrane protein ABC transporter OppB (Mycobacterium tuberculosis H37Rv)
MTRYLARRLLNYLVLLALASFLTYCLTSLAFSPLESLMQRSPRPPQAVIDAKAHDLGLDR
PILARYANWVSHAVRGDFGTTITGQPVGTELGRRIGVSLRLLVVGSVFGTVAGVVIGAWG
AIRQYRLSDRVMTTLALLVLSTPTFVVANLLILGALRVNWAVGIQLFDYTGETSPGVAGG
VWDRLGDRLQHLILPSLTLALAAAAGFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALLK
HGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEWMVRGISTQDTNIVAAITVFS
GAVVLLAGLLSDVIYAALDPRVRVS