Protein Info for Rv1276c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00300: His_Phos_1" amino acids 1 to 71 (71 residues), 27.4 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 100% identical to Y1276_MYCTO: Uncharacterized protein MT1313 (MT1313) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 99% identity to mbt:JTY_1310)

Predicted SEED Role

"Phosphohistidine phosphatase SixA"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>Rv1276c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MRHAKSAYPDGIADHDRPLAPRGIREAGLAGGWLRANLPAVDAVLCSTATRARQTLAHTG
IDAPARYAERLYGAAPGTVIEEINRVGDNVTTLLVVGHEPTTSALAIVLASISGTDAAVA
ERISEKFPTSGIAVLRVAGHWADVEPGCAALVGFHVPR