Protein Info for Rv1273c in Mycobacterium tuberculosis H37Rv

Annotation: Probable drugs-transport transmembrane ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 55 to 78 (24 residues), see Phobius details amino acids 125 to 151 (27 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 18 to 288 (271 residues), 186.1 bits, see alignment E=1.1e-58 PF00005: ABC_tran" amino acids 352 to 501 (150 residues), 97.5 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 100% identical to Y1304_MYCBO: Uncharacterized ABC transporter ATP-binding protein Mb1304c (BQ2027_MB1304C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to mtu:Rv1273c)

Predicted SEED Role

"FIG01956052: Probable drugs-transport transmembrane ATP-binding protein ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>Rv1273c Probable drugs-transport transmembrane ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MLLALLRQHIRPYRRLVAMLMMLQLVSTLASLYLPTVNAAIVDDGVAKGDTATIVRLGAV
MLGVTGLQVLCAIGAVYLGSRTGAGFGRDLRSAMFEHIITFSERETARFGAPTLLTRSTN
DVRQILFLVQMTATVLVTAPIMCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHML
PLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANTALSNAALSAGNWQAL
MLPVTTLTINASSVALIWFGGLRIDSGQMQVGSLIAFLSYFAQILMAVLMATMTLAVLPR
ASVCAERITEVLSTPAALGNPDNPKFPTDGVTGVVRLAGATFTYPGADCPVLQDISLTAR
PGTTTAIVGSTGSGKSTLVSLICRLYDVTAGAVLVDGIDVREYHTERLWSAIGLVPQRSY
LFSGTVADNLRYGGGPDQVVTEQEMWEALRVAAADGFVQTDGLQTRVAQGGVNFSGGQRQ
RLAIARAVIRRPAIYVFDDAFSALDVHTDAKVHASLRQVSGDATIIVVTQRISNAAQADQ
VIVVDNGKIVGTGTHETLLADCPTYAEFAASQSLSATVGGVG